What is longer, pneumonoultramicroscopicsilicovolcanoconiosis or hippopotomonstrosesquippedaliophobia?
Pneumonoultramicroscopicsilicovolcanoconiosis is longer, containing 45 letters compared to the 36 letters in hippopotomonstrosesquippedaliophobia.Is hippopotomonstrosesquippedaliophobia the 3rd longest word?
The 21st is hippopotomonstrosesquippedaliophobia, which is fear of long words. Apologies to anyone who suffers from this condition with its 36-letter name—we're sure we've made it worse.)Is there a 190000 letter word?
While pneumonoultramicroscopicsilicovolcanoconiosis is the longest word in the English dictionary, an even longer word exists outside the dictionary. The extended term for “titin” has 189,819 letters, but the first 61 letters are methionylthreonylthreonylglutaminylarginyltyrosylglutamylsery.Which word has 1000 letters?
The longest word in the English languageWe've struck out chemical names based on the endless number of proteins, some over 1,000 letters each. Neither will we include place names due to their coinage. domrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit.
What word takes 3 hours to say methionylthreonylthreonylglutaminylarginyl?
The longest word in the English language is: Methionylthreonylthreonylglutaminylarginyl... isoleucine (ellipses necessary). It's the full name of the largest known protein, more commonly referred to as Titin. What's the funniest or most interesting word or phrase you've come across?when you have hippopotomonstrosesquippedaliophobia
Is "supercalifragilisticexpialidocious" a real word?
Supercalifragilisticexpialidocious is a nonsensical word, origin in the 1930s based on super, popularized by the 1964 film Mary Poppins. It simply means “extraordinarily good” or describes something as being great or extraordinary.Is 30000 words a good vocabulary?
Native speakers typically know between 15,000 and 30,000 words, depending on their education level and reading habits. A well-educated native speaker might recognize 30,000+ words passively, though they only use maybe 10,000 regularly in conversation.Is it possible to spell aequeosalinocalcalinoceraceoaluminosocupreovitriolic?
Aequeosalinocalcalinoceraceoaluminosocupreovitriolic. This is the longest word in English which is composed of seven words. This 52-letter word was coined by Dr. Edward Strother to describe the spa waters in Bath, England.What is the meaning of aequeosalinocalcalinoceraceoaluminosocupreovitriolic?
Aequeosalinocalcalinoceraceoaluminosocupreovitriolic, at 52 letters, describing the spa waters at Bath, England, is attributed to Dr. Edward Strother (1675–1737).Is eellogofusciouhipoppokunurious a real word?
“Eellogofusciouhipoppokunurious” is a 30-letter adjective that means “very good or fine.” It's one of the longest words in English. For example, “The chef's special dessert was nothing short of eellogofusciouhipoppokunurious—a truly delightful treat!”Where is titin found in the body?
Titin1, also called connectin, is the largest known protein. It is found in the striated muscle tissue of humans and other vertebrates; homologous proteins exist in invertebrate animal families.What is the stupidest phobia?
1. Arachibutyrophobia (Fear of peanut butter sticking to the roof of your mouth) Arachibutyrophobia is the fear of peanut butter sticking to the roof of your mouth. While the phenomenon has happened to everyone at one point or another, people with arachibutyrophobia are extremely afraid of it.What does friggatriskaidekaphobia mean?
NBC Universal, Inc. Triskaidekaphobia is the fear of the number 13. Here's how experts think the number 13 got its bad reputation. Many people have araskavedekatriaphobia (also known as friggatriskaidekaphobia), or fear of Friday the 13th.What phobia is 666?
Hexakosioihexekontahexaphobia causes an overwhelming and persistent fear of the number 666. It likely relates to a reference in a New Testament verse talking about the number of the beast and 666. There are various interpretations of the verse, some of which imply the number signifies the Antichrist or Satan.Is 70k words a lot?
The average word count for adult fiction is between 70,000 to 120,000 words. For children's fiction, the general rule is the younger the audience the shorter the book, and for YA novels the average is 50,000-70,000 words. Non-fiction word counts sit between 70,000-120,000 words.Who can speak 42 languages fluently?
Powell Alexander Janulus (born 1939) is a Canadian polyglot who lives in White Rock, British Columbia, and entered the Guinness World Records in 1985 for fluency in 42 languages.Does 1 zillion exist?
If you wonder why “zillion” is not a part of the list, then tell us that Zillion is not a real number. It is a term that people have made up the word Zillion to refer to an undetermined number extremely large in quantity.How big is a sextillion?
Sextillion may mean either of the two numbers (see long and short scales for more detail): 1,000,000,000,000,000,000,000 (one thousand million million million; 1021; SI prefix zetta-) for all short scale countries.What are 20 silent words?
Here are some examples of silent consonants:- b: dumb, thumb.
- c: indict.
- ch: yacht.
- d: bridge, ledge, edge.
- g: foreign, sign, design, assign.
- h: rhinoceros, spaghetti.
- k: knee, knit, knob, know, knuckle.
- l: calf, talk, could, should, would.
What is the 3 hour word?
The longest word in the world that takes 3 hours to say is the chemical name for the protein “titin.” This word has 189,819 letters. The first 35 letters are “methionylthreonylthreonylglutaminyl” and the last 10 are “isoleucine.” It takes around 3 hours to pronounce and when written, takes up over 100 pages.Which word has 645 meanings?
The little word "run" — in its verb form alone — has 645 distinct meanings.
← Previous question
How to watch a video that is unavailable?
How to watch a video that is unavailable?
Next question →
What's the most expensive item of clothing?
What's the most expensive item of clothing?